PDB entry 1clm

View 1clm on RCSB PDB site
Description: structure of paramecium tetraurelia calmodulin at 1.8 angstroms resolution
Deposited on 1993-01-23, released 1993-10-31
The last revision prior to the SCOP 1.57 freeze date was dated 1995-01-15, with a file datestamp of 1995-01-19.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1clm__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1clm_ (-)
    lteeqiaefkeafalfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti
    dfpeflslmarkmkeqdseeelieafkvfdrdgnglisaaelrhvmtnlgekltddevde
    mireadidgdghinyeefvrmmvs