PDB entry 1clk

View 1clk on RCSB PDB site
Description: crystal structure of streptomyces diastaticus no.7 strain m1033 xylose isomerase at 1.9 a resolution with pseudo-i222 space group
Deposited on 1999-04-29, released 2000-05-03
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-03, with a file datestamp of 2000-05-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.186
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1clka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1clkA (A:)
    syqptpedkftfglwtvgwqgrdpfgdatrgaldpaesvrrlaelgahgvtfhdddlipf
    gatdseraehikrfrqaldetgmkvpmattnlfthpvfkdggftandrdvrryalrktir
    nidlavelgaqtyvawggregaesgaakdvrvaldrmkeafdllgeyvtsqgydtpfaie
    pkpneprgdillptighalafidglerpelygvnpevgheqmaglnfphgiaqalwagkl
    fhidlngqsgikydqdlrfgpgdlraafwlvdllesagyegprhfdfkpprtedfdgvwa
    saagcmrnylilkeraaafradpevqealraarldelaqptagdglqallpdrsafedfd
    pdaaaargmaferldqlamdhllgarg