PDB entry 1clk

View 1clk on RCSB PDB site
Description: crystal structure of streptomyces diastaticus no.7 strain m1033 xylose isomerase at 1.9 a resolution with pseudo-i222 space group
Class: isomerase
Keywords: isomerase, xylose isomerase, glucose isomerase, streptomyces, pseudo-i222
Deposited on 1999-04-29, released 2000-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylose isomerase
    Species: Streptomyces diastaticus [TaxId:1956]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50910 (0-386)
      • conflict (76)
      • conflict (114)
      • conflict (264)
    Domains in SCOPe 2.07: d1clka_
  • Heterogens: MG, CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1clkA (A:)
    syqptpedkftfglwtvgwqgrdpfgdatrgaldpaesvrrlaelgahgvtfhdddlipf
    gatdseraehikrfrqaldetgmkvpmattnlfthpvfkdggftandrdvrryalrktir
    nidlavelgaqtyvawggregaesgaakdvrvaldrmkeafdllgeyvtsqgydtpfaie
    pkpneprgdillptighalafidglerpelygvnpevgheqmaglnfphgiaqalwagkl
    fhidlngqsgikydqdlrfgpgdlraafwlvdllesagyegprhfdfkpprtedfdgvwa
    saagcmrnylilkeraaafradpevqealraarldelaqptagdglqallpdrsafedfd
    pdaaaargmaferldqlamdhllgarg