PDB entry 1cli

View 1cli on RCSB PDB site
Description: x-ray crystal structure of aminoimidazole ribonucleotide synthetase (purm), from the e. coli purine biosynthetic pathway, at 2.5 a resolution
Deposited on 1999-04-28, released 1999-10-06
The last revision prior to the SCOP 1.71 freeze date was dated 2000-03-06, with a file datestamp of 2000-03-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.192
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cliA (A:)
    vtdktslsykdagvdidagnalvgrikgvvkktrrpevmgglggfgalcalpqkyrepvl
    vsgtdgvgtklrlamdlkrhdtigidlvamcvndlvvqgaeplffldyyatgkldvdtas
    avisgiaegclqsgcslvggetaempgmyhgedydvagfcvgvvekseiidgskvsdgdv
    lialgssgphsngyslvrkilevsgcdpqtteldgkpladhllaptriyvksvleliekv
    dvhaiahltgggfweniprvlpdntqavidesswqwpevfnwlqtagnvehhemyrtfnc
    gvgmiialpapevdkalallnangenawkigiikasdseqrvvie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cliA (A:)
    tslsykdagvdidagnalvgrikgvvkktrrpevmgglggfgalcalpqkyrepvlvsgt
    dgvgtklrlamdlkrhdtigidlvamcvndlvvqgaeplffldyyatgkldvdtasavis
    giaegclqsgcslvggetaempgmyhgedydvagfcvgvvekseiidgskvsdgdvlial
    gssgphsngyslvrkilevsgcdpqtteldgkpladhllaptriyvksvleliekvdvha
    iahltgggfweniprvlpdntqavidesswqwpevfnwlqtagnvehhemyrtfncgvgm
    iialpapevdkalallnangenawkigiikasdseqrvvie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cliB (B:)
    vtdktslsykdagvdidagnalvgrikgvvkktrrpevmgglggfgalcalpqkyrepvl
    vsgtdgvgtklrlamdlkrhdtigidlvamcvndlvvqgaeplffldyyatgkldvdtas
    avisgiaegclqsgcslvggetaempgmyhgedydvagfcvgvvekseiidgskvsdgdv
    lialgssgphsngyslvrkilevsgcdpqtteldgkpladhllaptriyvksvleliekv
    dvhaiahltgggfweniprvlpdntqavidesswqwpevfnwlqtagnvehhemyrtfnc
    gvgmiialpapevdkalallnangenawkigiikasdseqrvvie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cliB (B:)
    alvgrikgvvkktrrpevmgglggfgalcalpqkyrepvlvsgtdgvgtklrlamdlkrh
    dtigidlvamcvndlvvqgaeplffldyyatgkldvdtasavisgiaegclqsgcslvgg
    etaempgmyhgedydvagfcvgvvekseiidgskvsdgdvlialgssgphsngyslvrki
    levsgcdpqtteldgkpladhllaptriyvksvleliekvdvhaiahltgggfweniprv
    lpdntqavidesswqwpevfnwlqtagnvehhemyrtfncgvgmiialpapevdkalall
    nangenawkigiikasdseqrvvie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cliC (C:)
    vtdktslsykdagvdidagnalvgrikgvvkktrrpevmgglggfgalcalpqkyrepvl
    vsgtdgvgtklrlamdlkrhdtigidlvamcvndlvvqgaeplffldyyatgkldvdtas
    avisgiaegclqsgcslvggetaempgmyhgedydvagfcvgvvekseiidgskvsdgdv
    lialgssgphsngyslvrkilevsgcdpqtteldgkpladhllaptriyvksvleliekv
    dvhaiahltgggfweniprvlpdntqavidesswqwpevfnwlqtagnvehhemyrtfnc
    gvgmiialpapevdkalallnangenawkigiikasdseqrvvie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cliC (C:)
    tslsykdagvdidagnalvgrikgvvkktrrpevmgglggfgalcalpqkyrepvlvsgt
    dgvgtklrlamdlkrhdtigidlvamcvndlvvqgaeplffldyyatgkldvdtasavis
    giaegclqsgcslvggetaempgmyhgedydvagfcvgvvekseiidgskvsdgdvlial
    gssgphsngyslvrkilevsgcdpqtteldgkpladhllaptriyvksvleliekvdvha
    iahltgggfweniprvlpdntqavidesswqwpevfnwlqtagnvehhemyrtfncgvgm
    iialpapevdkalallnangenawkigiikasdseqrvvie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1cliD (D:)
    vtdktslsykdagvdidagnalvgrikgvvkktrrpevmgglggfgalcalpqkyrepvl
    vsgtdgvgtklrlamdlkrhdtigidlvamcvndlvvqgaeplffldyyatgkldvdtas
    avisgiaegclqsgcslvggetaempgmyhgedydvagfcvgvvekseiidgskvsdgdv
    lialgssgphsngyslvrkilevsgcdpqtteldgkpladhllaptriyvksvleliekv
    dvhaiahltgggfweniprvlpdntqavidesswqwpevfnwlqtagnvehhemyrtfnc
    gvgmiialpapevdkalallnangenawkigiikasdseqrvvie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cliD (D:)
    alvgrikgvvkktrrpevmgglggfgalcalpqkyrepvlvsgtdgvgtklrlamdlkrh
    dtigidlvamcvndlvvqgaeplffldyyatgkldvdtasavisgiaegclqsgcslvgg
    etaempgmyhgedydvagfcvgvvekseiidgskvsdgdvlialgssgphsngyslvrki
    levsgcdpqtteldgkpladhllaptriyvksvleliekvdvhaiahltgggfweniprv
    lpdntqavidesswqwpevfnwlqtagnvehhemyrtfncgvgmiialpapevdkalall
    nangenawkigiikasdseqrvvie