PDB entry 1clh

View 1clh on RCSB PDB site
Description: three-dimensional solution structure of escherichia coli periplasmic cyclophilin
Class: isomerase(peptidyl-prolyl cis-trans)
Keywords: isomerase(peptidyl-prolyl cis-trans)
Deposited on 1993-12-20, released 1994-05-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin
    Species: Escherichia coli [TaxId:562]
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1clha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1clhA (A:)
    akgdphvllttsagnieleldkqkapvsvqnfvdyvnsgfynnttfhrvipgfmiqgggf
    teqmqqkkpnppikneadnglrntrgtiamartadkdsatsqffinvadnafldhgqrdf
    gyavfgkvvkgmdvadkisqvpthdvgpyqnvpskpvvilsakvlp