PDB entry 1clf

View 1clf on RCSB PDB site
Description: clostridium pasteurianum ferredoxin
Deposited on 1995-06-21, released 1996-01-29
The last revision prior to the SCOP 1.55 freeze date was dated 1996-01-29, with a file datestamp of 1996-01-31.
Experiment type: NMR16
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1clf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1clf_ (-)
    aykiadscvscgacasecpvnaisqgdsifvidadtcidcgncanvcpvgapvqe