PDB entry 1clf

View 1clf on RCSB PDB site
Description: clostridium pasteurianum ferredoxin
Class: electron transfer (iron-sulfur protein)
Keywords: electron transfer (iron-sulfur protein)
Deposited on 1995-06-21, released 1996-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ferredoxin
  Species: Clostridium pasteurianum [TaxId:1501]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00195 (0-54)
  Domains in SCOPe 2.08: d1clfa_
• Heterogens: SF4

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1clfA (A:)
  aykiadscvscgacasecpvnaisqgdsifvidadtcidcgncanvcpvgapvqe