PDB entry 1cle

View 1cle on RCSB PDB site
Description: structure of uncomplexed and linoleate-bound candida cylindracea cholesterol esterase
Deposited on 1995-02-08, released 1996-03-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.149
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1clea_
  • Chain 'B':
    Domains in SCOP 1.55: d1cleb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cleA (A:)
    aptaklangdtitglnaiineaflgipfaeppvgnlrfkdpvpysgslngqkftsygpsc
    mqqnpegtfeenlgktaldlvmqskvfqavlpqsedcltinvvrppgtkaganlpvmlwi
    fgggfeigsptifppaqmvtksvlmgkpiihvavnyrvaswgflagddikaegsgnaglk
    dqrlgmqwvadniagfggdpskvtifgesagsmsvlchliwndgdntykgkplfragimq
    sgamvpsdpvdgtygneiydlfvssagcgsasdklaclrsassdtlldatnntpgflays
    slrlsylprpdgknitddmyklvrdgkyasvpviigdqndegtvfglsslnvttnaqara
    yfkqsfihasdaeidtlmaaypqditqgspfdtgifnaitpqfkrisavlgdlafiharr
    yflnhfqggtkysflskqlsglpimgtfhandivwqdyllgsgsviynnafiafatdldp
    ntagllvnwpkytsssqsgnnlmminalglytgkdnfrtagydalmtnpssffv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cleB (B:)
    aptaklangdtitglnaiineaflgipfaeppvgnlrfkdpvpysgslngqkftsygpsc
    mqqnpegtfeenlgktaldlvmqskvfqavlpqsedcltinvvrppgtkaganlpvmlwi
    fgggfeigsptifppaqmvtksvlmgkpiihvavnyrvaswgflagddikaegsgnaglk
    dqrlgmqwvadniagfggdpskvtifgesagsmsvlchliwndgdntykgkplfragimq
    sgamvpsdpvdgtygneiydlfvssagcgsasdklaclrsassdtlldatnntpgflays
    slrlsylprpdgknitddmyklvrdgkyasvpviigdqndegtvfglsslnvttnaqara
    yfkqsfihasdaeidtlmaaypqditqgspfdtgifnaitpqfkrisavlgdlafiharr
    yflnhfqggtkysflskqlsglpimgtfhandivwqdyllgsgsviynnafiafatdldp
    ntagllvnwpkytsssqsgnnlmminalglytgkdnfrtagydalmtnpssffv