PDB entry 1cld

View 1cld on RCSB PDB site
Description: DNA-binding protein
Class: transcription regulation
Keywords: zinc-binding domain, transcription regulation
Deposited on 1995-06-06, released 1995-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cd2-lac9
    Species: KLUYVEROMYCES LACTIS [TaxId:28985]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1clda_
  • Heterogens: CD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cldA (A:)
    mkkssevmhqacdacrkkkwkcsktvptctnclkynldcvyspqvvrtpltrahltemen
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cldA (A:)
    qacdacrkkkwkcsktvptctnclkynldcvys