PDB entry 1clb

View 1clb on RCSB PDB site
Description: Determination of the solution structure of apo calbindin D9K by nmr spectroscopy
Class: calcium-binding protein
Keywords: ef-hand, calcium-binding protein
Deposited on 1995-02-08, released 1995-04-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calbindin d9k
    Species: Bos taurus [TaxId:9913]
    Gene: ICABP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02633 (1-75)
      • conflict (43)
    Domains in SCOPe 2.08: d1clba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1clbA (A:)
    mkspeelkgifekyaakegdpnqlskeelklllqtefpsllkggstldelfeeldkngdg
    evsfeefqvlvkkisq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1clbA (A:)
    kspeelkgifekyaakegdpnqlskeelklllqtefpsllkggstldelfeeldkngdge
    vsfeefqvlvkkisq