PDB entry 1cla

View 1cla on RCSB PDB site
Description: evidence for transition-state stabilization by serine-148 in the catalytic mechanism of chloramphenicol acetyltransferase
Class: transferase (acyltransferase)
Keywords: transferase (acyltransferase)
Deposited on 1989-10-16, released 1990-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.172
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: type III chloramphenicol acetyltransferase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00484 (0-212)
    • conflict (141)
  Domains in SCOPe 2.08: d1claa_
• Heterogens: CO, CLM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1claA (A:)
  mnytkfdvknwvrrehfefyrhrlpcgfsltskidittlkkslddsaykfypvmiyliaq
  avnqfdelrmaikddelivwdsvdpqftvfhqetetfsalscpyssdidqfmvnylsvme
  ryksdtklfpqgvtpenhlniaalpwvnfdsfnlnvanftdyfapiitmakyqqegdrll
  lplsvqvhhavcdgfhvarfinrlqelcnsklk