PDB entry 1cl7

View 1cl7 on RCSB PDB site
Description: anti hiv1 protease fab
Class: immune system
Keywords: fab fragment, cross-reactivity, hiv1 protease, enzyme inhibition, immunoglobulin, immune system
Deposited on 1999-05-06, released 2000-01-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.183
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: PROTEIN (IGG1 ANTIBODY 1696 (variable heavy chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1CL7 (0-134)
    Domains in SCOPe 2.03: d1cl7.1, d1cl7h1
  • Chain 'I':
    Compound: PROTEIN (IGG1 ANTIBODY 1696 (constant heavy chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1cl7.1
  • Chain 'L':
    Compound: PROTEIN (IGG1 ANTIBODY 1696 (light chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1CL7 (0-215)
    Domains in SCOPe 2.03: d1cl7l1, d1cl7l2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cl7H (H:)
    qiqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf
    addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvss
    akttppsvyplapgs
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cl7I (I:)
    smvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvpssprpsetv
    tcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cl7L (L:)
    dvlmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr