PDB entry 1cl7

View 1cl7 on RCSB PDB site
Description:
Deposited on 1999-05-06, released 2000-01-12
The last revision prior to the SCOP 1.65 freeze date was dated 2000-01-12, with a file datestamp of 2000-01-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.183
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1cl7.1, d1cl7h1
  • Chain 'I':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1cl7.1
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1cl7l1, d1cl7l2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cl7H (H:)
    qiqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf
    addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvss
    akttppsvyplapgs
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cl7I (I:)
    smvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvpssprpsetv
    tcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cl7L (L:)
    dvlmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr