PDB entry 1cl5

View 1cl5 on RCSB PDB site
Description: crystal structure of phospholipase a2 from daboia russelli pulchella
Class: hydrolase
Keywords: phospholipase a2, neurotoxic, daboia russelli pulchella, hydrolase
Deposited on 1999-05-06, released 1999-05-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (phospholipase a2)
    Species: Daboia russellii pulchella [TaxId:97228]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cl5a_
  • Chain 'B':
    Compound: protein (phospholipase a2)
    Species: Daboia russellii pulchella [TaxId:97228]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cl5b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cl5A (A:)
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cl5B (B:)
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c