PDB entry 1cl4

View 1cl4 on RCSB PDB site
Description: nucleocapsid protein from mason-pfizer monkey virus (mpmv)
Class: Viral protein
Keywords: nucleocapsid protein, RNA binding protein, retrovirus, viral protein
Deposited on 1999-05-06, released 1999-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (gag polyprotein)
    Species: Mason-Pfizer monkey virus [TaxId:11855]
    Gene: NCP14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cl4a_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cl4A (A:)
    ggscfkcgkkghfaknchehahnnaepkvpglcprckrgkhwanecksktdnqgnpipph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cl4A (A:)
    vpglcprckrgkhwanecksktdnqgnpipph