PDB entry 1cl2

View 1cl2 on RCSB PDB site
Description:
Deposited on 1997-09-04, released 1998-09-09
The last revision prior to the SCOP 1.57 freeze date was dated 1998-10-14, with a file datestamp of 1998-10-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.19
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1cl2a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1cl2b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cl2A (A:)
    kldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrgtlth
    fslqqamceleggagcvlfpcgaaavansilafieqgdhvlmtntayepsqdfcskilsk
    lgvttswfdpligadivkhlqpntkivflespgsitmevhdvpaivaavrsvvpdaiimi
    dntwaagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcweqlrenaylmgqmv
    dadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefwkrdf
    tgssglfsfvlkkklnneelanyldnfslfsmayswggyeslilanqpehiaairpqgei
    dfsgtlirlhigledvddliadldagfariv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cl2B (B:)
    kkldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrgtlt
    hfslqqamceleggagcvlfpcgaaavansilafieqgdhvlmtntayepsqdfcskils
    klgvttswfdpligadivkhlqpntkivflespgsitmevhdvpaivaavrsvvpdaiim
    idntwaagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcweqlrenaylmgqm
    vdadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefwkrd
    ftgssglfsfvlkkklnneelanyldnfslfsmayswggyeslilanqpehiaairpqge
    idfsgtlirlhigledvddliadldagfariv