PDB entry 1cl1

View 1cl1 on RCSB PDB site
Description: cystathionine beta-lyase (cbl) from escherichia coli
Class: methionine biosynthesis
Keywords: plp-dependent enzymes, methionine biosynthesis, c-s beta lyase
Deposited on 1997-09-02, released 1998-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.151
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystathionine beta-lyase
    Species: Escherichia coli [TaxId:83333]
    Gene: METC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06721 (Start-394)
      • modified residue (209)
    Domains in SCOPe 2.08: d1cl1a_
  • Chain 'B':
    Compound: Cystathionine beta-lyase
    Species: Escherichia coli [TaxId:83333]
    Gene: METC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06721 (Start-394)
      • modified residue (209)
    Domains in SCOPe 2.08: d1cl1b_
  • Heterogens: BCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cl1A (A:)
    madkkldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrg
    tlthfslqqamceleggagcvlfpcgaaavansilafieqgdhvlmtntayepsqdfcsk
    ilsklgvttswfdpligadivkhlqpntkivflespgsitmevhdvpaivaavrsvvpda
    iimidntwaagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcweqlrenaylm
    gqmvdadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefw
    krdftgssglfsfvlkkklnneelanyldnfslfsmayswggyeslilanqpehiaairp
    qgeidfsgtlirlhigledvddliadldagfariv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cl1A (A:)
    kldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrgtlth
    fslqqamceleggagcvlfpcgaaavansilafieqgdhvlmtntayepsqdfcskilsk
    lgvttswfdpligadivkhlqpntkivflespgsitmevhdvpaivaavrsvvpdaiimi
    dntwaagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcweqlrenaylmgqmv
    dadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefwkrdf
    tgssglfsfvlkkklnneelanyldnfslfsmayswggyeslilanqpehiaairpqgei
    dfsgtlirlhigledvddliadldagfariv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cl1B (B:)
    madkkldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrg
    tlthfslqqamceleggagcvlfpcgaaavansilafieqgdhvlmtntayepsqdfcsk
    ilsklgvttswfdpligadivkhlqpntkivflespgsitmevhdvpaivaavrsvvpda
    iimidntwaagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcweqlrenaylm
    gqmvdadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefw
    krdftgssglfsfvlkkklnneelanyldnfslfsmayswggyeslilanqpehiaairp
    qgeidfsgtlirlhigledvddliadldagfariv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cl1B (B:)
    kkldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrgtlt
    hfslqqamceleggagcvlfpcgaaavansilafieqgdhvlmtntayepsqdfcskils
    klgvttswfdpligadivkhlqpntkivflespgsitmevhdvpaivaavrsvvpdaiim
    idntwaagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcweqlrenaylmgqm
    vdadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefwkrd
    ftgssglfsfvlkkklnneelanyldnfslfsmayswggyeslilanqpehiaairpqge
    idfsgtlirlhigledvddliadldagfariv