PDB entry 1cl0

View 1cl0 on RCSB PDB site
Description: crystal structure of reduced thioredoxin reductase from escherichia coli.
Class: oxidoreductase
Keywords: flavoenzyme, oxidoreductase
Deposited on 1999-05-04, released 1999-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin reductase
    Species: Escherichia coli [TaxId:562]
    Gene: trxB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cl0a1, d1cl0a2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cl0A (A:)
    gttkhskllilgsgpagytaavyaaranlqpvlitgmekggqlttttevenwpgdpndlt
    gpllmermhehatkfeteiifdhinkvdlqnrpfrlngdngeytcdaliiatgasarylg
    lpseeafkgrgvsacatcdgffyrnqkvavigggntaveealylsniasevhlihrrdgf
    raekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvaglf
    vaighspntaifegqlelengyikvqsgihgnatqtsipgvfaagdvmdhiyrqaitsag
    tgcmaaldaeryldgladak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cl0A (A:)
    gttkhskllilgsgpagytaavyaaranlqpvlitgmekggqlttttevenwpgdpndlt
    gpllmermhehatkfeteiifdhinkvdlqnrpfrlngdngeytcdaliiatgasarylg
    lpseeafkgrgvsacatcdgffyrnqkvavigggntaveealylsniasevhlihrrdgf
    raekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvaglf
    vaighspntaifegqlelengyikvqsgihgnatqtsipgvfaagdvmdhiyrqaitsag
    tgcmaaldaeryldgla