PDB entry 1cku

View 1cku on RCSB PDB site
Description: ab initio solution and refinement of two high potential iron protein structures at atomic resolution
Class: electron transfer protein
Keywords: electron transfer protein, atomic resolution, direct methods, iron-sulphur cluster, metalloprotein
Deposited on 1999-04-24, released 1999-05-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.128
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hipip)
    Species: Allochromatium vinosum [TaxId:1049]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ckua_
  • Chain 'B':
    Compound: protein (hipip)
    Species: Allochromatium vinosum [TaxId:1049]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ckub_
  • Heterogens: SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ckuA (A:)
    sapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaagatdew
    kgcqlfpgklinvngwcaswtlkag
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ckuB (B:)
    sapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaagatdew
    kgcqlfpgklinvngwcaswtlkag