PDB entry 1ckt

View 1ckt on RCSB PDB site
Description: crystal structure of hmg1 domain a bound to a cisplatin-modified dna duplex
Deposited on 1999-04-23, released 1999-06-30
The last revision prior to the SCOP 1.69 freeze date was dated 1999-12-18, with a file datestamp of 1999-12-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.238
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1ckta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cktA (A:)
  kprgkmssyaffvqtcreehkkkhpdasvnfsefskkcserwktmsakekgkfedmakad
  karyeremkty