PDB entry 1ckt

View 1ckt on RCSB PDB site
Description: crystal structure of hmg1 domain a bound to a cisplatin-modified DNA duplex
Class: gene regulation/DNA
Keywords: high-mobility group domain, bent DNA, protein-drug-DNA complex, gene regulation-DNA complex
Deposited on 1999-04-23, released 1999-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.238
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high mobility group 1 protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ckta_
  • Chain 'B':
    Compound: DNA (5'-d(*cp*cp*(5iu)p*cp*tp*cp*tp*gp*gp*ap*cp*cp*tp*tp*cp*c)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*gp*gp*ap*ap*gp*gp*tp*cp*cp*ap*gp*ap*gp*ap*gp*g)-3')
  • Heterogens: CPT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cktA (A:)
    kprgkmssyaffvqtcreehkkkhpdasvnfsefskkcserwktmsakekgkfedmakad
    karyeremkty
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.