PDB entry 1ckt

View 1ckt on RCSB PDB site
Description: crystal structure of hmg1 domain a bound to a cisplatin-modified DNA duplex
Class: gene regulation/DNA
Keywords: high-mobility group domain, bent DNA, protein-drug-DNA complex, gene regulation-DNA complex
Deposited on 1999-04-23, released 1999-06-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.238
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: high mobility group 1 protein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63159 (0-70)
  Domains in SCOPe 2.08: d1ckta_
• Chain 'B':
  Compound: DNA (5'-d(*cp*cp*(5iu)p*cp*tp*cp*tp*gp*gp*ap*cp*cp*tp*tp*cp*c)-3')
  
• Chain 'C':
  Compound: DNA (5'-d(*gp*gp*ap*ap*gp*gp*tp*cp*cp*ap*gp*ap*gp*ap*gp*g)-3')
  
• Heterogens: CPT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cktA (A:)
  kprgkmssyaffvqtcreehkkkhpdasvnfsefskkcserwktmsakekgkfedmakad
  karyeremkty
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.