PDB entry 1ckr

View 1ckr on RCSB PDB site
Description: high resolution solution structure of the heat shock cognate-70 kd substrate binding domain obtained by multidimensional nmr techniques
Deposited on 1999-04-22, released 1999-04-30
The last revision prior to the SCOP 1.67 freeze date was dated 1999-11-25, with a file datestamp of 1999-11-24.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ckra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ckrA (A:)
    senvqdlllldvtplslgietaggvmtvlikrnttiptkqtqtfttysdnqpgvliqvye
    geramtkdnnllgkfeltgippaprgvpqievtfdidangilnvsavdkstgkenkitit
    ndkgrlskediermvqeaekykaedekqrdkvssknsle