PDB entry 1ckq

View 1ckq on RCSB PDB site
Description: pre-transition state eco ri endonuclease/cognate DNA (tcgcgaattcgcg) complex
Class: protein/DNA
Keywords: sequence-specific DNA-protein complex, protein/DNA complex
Deposited on 1999-04-22, released 1999-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.235
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (endonuclease)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ckqa_
  • Chain 'B':
    Compound: DNA (5'-d(*tp*cp*gp*cp*gp*ap*ap*tp*tp*cp*gp*cp*g)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ckqA (A:)
    snkkqsnrlteqhklsqgvigifgdyakahdlavgevsklvkkalsneypqlsfryrdsi
    kkteinealkkidpdlggtlfvsnssikpdggivevkddygewrvvlvaeakhqgkdiin
    irngllvgkrgdqdlmaagnaiershkniseianfmlseshfpyvlflegsnfltenisi
    trpdgrvvnleynsgilnrldrltaanygmpinsnlcinkfvnhkdksimlqaasiytqg
    dgrewdskimfeimfdisttslrvlgrdlfeqltsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ckqA (A:)
    sqgvigifgdyakahdlavgevsklvkkalsneypqlsfryrdsikkteinealkkidpd
    lggtlfvsnssikpdggivevkddygewrvvlvaeakhqgkdiinirngllvgkrgdqdl
    maagnaiershkniseianfmlseshfpyvlflegsnfltenisitrpdgrvvnleynsg
    ilnrldrltaanygmpinsnlcinkfvnhkdksimlqaasiytqgdgrewdskimfeimf
    disttslrvlgrdlfeqltsk
    

  • Chain 'B':
    No sequence available.