PDB entry 1ckl

View 1ckl on RCSB PDB site
Description: n-terminal two domains of human cd46 (membrane cofactor protein, mcp)
Class: glycoprotein
Keywords: virus receptor, complement cofactor, short consensus repeat, scr, measles virus, glycoprotein
Deposited on 1999-04-22, released 1999-06-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.244
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cd46)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ckla1, d1ckla2
  • Chain 'B':
    Compound: protein (cd46)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cklb1, d1cklb2
  • Chain 'C':
    Compound: protein (cd46)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cklc1, d1cklc2
  • Chain 'D':
    Compound: protein (cd46)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ckld1, d1ckld2
  • Chain 'E':
    Compound: protein (cd46)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ckle1, d1ckle2
  • Chain 'F':
    Compound: protein (cd46)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cklf1, d1cklf2
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cklA (A:)
    ceepptfeameligkpkpyyeigervdykckkgyfyipplathticdrnhtwlpvsddac
    yretcpyirdplngqavpangtyefgyqmhficnegyyligeeilycelkgsvaiwsgkp
    picekv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cklB (B:)
    ceepptfeameligkpkpyyeigervdykckkgyfyipplathticdrnhtwlpvsddac
    yretcpyirdplngqavpangtyefgyqmhficnegyyligeeilycelkgsvaiwsgkp
    picekv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cklC (C:)
    ceepptfeameligkpkpyyeigervdykckkgyfyipplathticdrnhtwlpvsddac
    yretcpyirdplngqavpangtyefgyqmhficnegyyligeeilycelkgsvaiwsgkp
    picekv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cklD (D:)
    ceepptfeameligkpkpyyeigervdykckkgyfyipplathticdrnhtwlpvsddac
    yretcpyirdplngqavpangtyefgyqmhficnegyyligeeilycelkgsvaiwsgkp
    picekv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cklE (E:)
    ceepptfeameligkpkpyyeigervdykckkgyfyipplathticdrnhtwlpvsddac
    yretcpyirdplngqavpangtyefgyqmhficnegyyligeeilycelkgsvaiwsgkp
    picekv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cklF (F:)
    ceepptfeameligkpkpyyeigervdykckkgyfyipplathticdrnhtwlpvsddac
    yretcpyirdplngqavpangtyefgyqmhficnegyyligeeilycelkgsvaiwsgkp
    picekv