PDB entry 1ckj

View 1ckj on RCSB PDB site
Description: casein kinase I delta truncation mutant containing residues 1-317 complex with bound tungstate
Class: phosphotransferase
Keywords: protein kinase
Deposited on 1995-08-25, released 1995-12-07
The last revision prior to the SCOP 1.73 freeze date was dated 1995-12-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.192
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: recombinant casein kinase I delta
    Species: Rattus norvegicus
    Gene: T7
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ckja_
  • Chain 'B':
    Compound: recombinant casein kinase I delta
    Species: Rattus norvegicus
    Gene: T7
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ckjb_
  • Heterogens: WO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ckjA (A:)
    melrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
    ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
    sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
    sinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievl
    ckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlkfgasra
    addaererrdreerlrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ckjA (A:)
    melrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
    ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
    sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
    sinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievl
    ckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlkfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ckjB (B:)
    melrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
    ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
    sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
    sinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievl
    ckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlkfgasra
    addaererrdreerlrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ckjB (B:)
    melrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
    ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
    sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
    sinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievl
    ckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml