PDB entry 1cki

View 1cki on RCSB PDB site
Description: recombinant casein kinase I delta truncation mutant containing residues 1-317
Class: phosphotransferase
Keywords: protein kinase, phosphotransferase
Deposited on 1995-08-25, released 1995-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.193
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: casein kinase I delta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: T7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ckia_
  • Chain 'B':
    Compound: casein kinase I delta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: T7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ckib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ckiA (A:)
    melrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
    ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
    sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
    sinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievl
    ckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlkfgasra
    addaererrdreerlrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ckiA (A:)
    melrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
    ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
    sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
    sinthlgieqsrrddleslgyvlmyfnlgslpwqglkyerisekkmstpievlckgypse
    fatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlkfgasr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ckiB (B:)
    melrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
    ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
    sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
    sinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievl
    ckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlkfgasra
    addaererrdreerlrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ckiB (B:)
    melrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
    ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
    sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
    sinthlgieqsrrddleslgyvlmyfnlgslpwqglkyerisekkmstpievlckgypse
    fatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml