PDB entry 1ckg

View 1ckg on RCSB PDB site
Description: t52v mutant human lysozyme
Class: hydrolase
Keywords: stability, hydrogen bond, hydrolase
Deposited on 1999-04-22, released 1999-05-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.166
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lysozyme)
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ckga_
  • Chain 'B':
    Compound: protein (lysozyme)
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ckgb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ckgA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrsvdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ckgB (B:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrsvdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv