PDB entry 1cke

View 1cke on RCSB PDB site
Description: cmp kinase from escherichia coli free enzyme structure
Class: transferase
Keywords: nucleotide monophosphate kinase,, transferase
Deposited on 1998-09-24, released 1999-09-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.205
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cytidine monophosphate kinase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ckea_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ckeA (A:)
    mtaiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedal
    vplashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqraf
    relpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqvkgfsvnferllaeike
    rddrdrnravaplvpaadalvldsttlsieqviekalqyarqklala
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ckeA (A:)
    aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
    lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
    lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqvkgfsvnferllaeiklvp
    aadalvldsttlsieqviekalqyarqklala