PDB entry 1cke

View 1cke on RCSB PDB site
Description: cmp kinase from escherichia coli free enzyme structure
Deposited on 1998-09-24, released 1999-09-20
The last revision prior to the SCOP 1.55 freeze date was dated 1999-09-20, with a file datestamp of 1999-09-19.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.205
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ckea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ckeA (A:)
    aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
    lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
    lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqvkgfsvnferllaeikerd
    drdrnravaplvpaadalvldsttlsieqviekalqyarqklala
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ckeA (A:)
    aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
    lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
    lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqvkgfsvnferllaeiklvp
    aadalvldsttlsieqviekalqyarqklala