PDB entry 1ckb

View 1ckb on RCSB PDB site
Description: structural basis for the specific interaction of lysine-containing proline-rich peptides with the n-terminal sh3 domain of c-crk
Deposited on 1995-01-24, released 1995-05-08
The last revision prior to the SCOP 1.57 freeze date was dated 1995-05-08, with a file datestamp of 1995-05-09.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ckba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ckbA (A:)
    aeyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyveky