PDB entry 1ckb

View 1ckb on RCSB PDB site
Description: structural basis for the specific interaction of lysine-containing proline-rich peptides with the n-terminal sh3 domain of c-crk
Class: complex (oncogene protein/peptide)
Keywords: complex (oncogene protein/peptide)
Deposited on 1995-01-24, released 1995-05-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-crk n-terminal sh3 domain
    Species: Mus musculus [TaxId:10090]
    Gene: PCR PRODUCT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ckba_
  • Chain 'B':
    Compound: sos peptide (pro-pro-pro-val-pro-pro-arg-arg-arg-arg)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1CKB (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ckbA (A:)
aeyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyveky

  • Chain 'B':
    No sequence available.