PDB entry 1ck9

View 1ck9 on RCSB PDB site
Description: solution structure of yeast ribosomal protein l30
Deposited on 1999-04-28, released 1999-10-14
The last revision was dated 2006-07-25, with a file datestamp of 2007-06-01.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (60s ribosomal protein l30)
    Species: Saccharomyces cerevisiae
    Gene: RPL30
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1ck9A (A:)
    apvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyam
    lsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla