PDB entry 1ck8

View 1ck8 on RCSB PDB site
Description:
Deposited on 1999-04-28, released 1999-12-02
The last revision prior to the SCOP 1.65 freeze date was dated 2000-03-27, with a file datestamp of 2000-03-27.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1ck8b_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ck8B (B:)
    apvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyam
    lsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla