PDB entry 1ck7

View 1ck7 on RCSB PDB site
Description: gelatinase a (full-length)
Class: hydrolase
Keywords: hydrolase (metalloprotease), full-length, metalloproteinase, gelatinase a
Deposited on 1999-04-28, released 1999-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.286
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ck7A (A:)
    apspiikfpgdvapktdkelavqylntfygcpkescnlfvlkdtlkkmqkffglpqtgdl
    dqntietmrkprcgnpdvanynffprkpkwdknqityriigytpdldpetvddafarafq
    vwsdvtplrfsrihdgeadiminfgrwehgdgypfdgkdgllahafapgtgvggdshfdd
    delwtlgegqvvrvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdg
    kygfcphealftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkky
    gfcpetamstvggnsegapcvfpftflgnkyesctsagrsdgkmwcattanydddrkwgf
    cpdqgyslflvaahafghamglehsqdpgalmapiytytknfrlsqddikgiqelygasp
    didlgtgptptlgpvtpeickqdivfdgiaqirgeifffkdrfiwrtvtprdkpmgpllv
    atfwpelpekidavyeapqeekavffagneywiysastlergypkpltslglppdvqrvd
    aafnwsknkktyifagdkfwrynevkkkmdpgfpkliadawnaipdnldavvdlqggghs
    yffkgayylklenqslksvkfgsiksdwlgc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ck7A (A:)
    pspiikfpgdvapktdkelavqylntfygcpkescnlfvlkdtlkkmqkffglpqtgdld
    qntietmrkprcgnpdvanynffprkpkwdknqityriigytpdldpetvddafarafqv
    wsdvtplrfsrihdgeadiminfgrwehgdgypfdgkdgllahafapgtgvggdshfddd
    elwtlgegqvvrvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgk
    ygfcphealftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkyg
    fcpetamstvggnsegapcvfpftflgnkyesctsagrsdgkmwcattanydddrkwgfc
    pdqgyslflvaahafghamglehsqdpgalmapiytytknfrlsqddikgiqelygaspl
    gpvtpeickqdivfdgiaqirgeifffkdrfiwrtvtprdkpmgpllvatfwpelpekid
    avyeapqeekavffagneywiysastlergypkpltslglppdvqrvdaafnwsknkkty
    ifagdkfwrynevkkkmdpgfpkliadawnaipdnldavvdlqggghsyffkgayylkle
    nqslksvkfgsiksdwlgc