PDB entry 1ck5

View 1ck5 on RCSB PDB site
Description:
Deposited on 1999-04-27, released 1999-12-02
The last revision prior to the SCOP 1.65 freeze date was dated 2000-03-27, with a file datestamp of 2000-03-27.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1ck5b_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ck5B (B:)
    apvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyam
    lsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla