PDB entry 1ck5

View 1ck5 on RCSB PDB site
Description: ribosomal protein l30-mrna complex from yeast
Deposited on 1999-04-27, released 1999-12-02
The last revision was dated 2006-07-25, with a file datestamp of 2007-06-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l30 33 nucleotide RNA yl32
    Species: Saccharomyces cerevisiae
    Gene: YSCRPL32
  • Chain 'B':
    Compound: 60s ribosomal protein l30
    Species: Saccharomyces cerevisiae
    Gene: YSCRPL32
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1ck5B (B:)
apvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyam
lsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla