PDB entry 1ck2

View 1ck2 on RCSB PDB site
Description: yeast (saccharomyces cerevisiae) ribosomal protein l30
Class: ribosome
Keywords: ribosomal protein, auto-regulation of pre-mRNA splicing and mRNA translation, ribosome
Deposited on 1999-04-26, released 1999-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 60s ribosomal protein l30
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RPL30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ck2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ck2A (A:)
apvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyam
lsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla