PDB entry 1ck0

View 1ck0 on RCSB PDB site
Description: anti-anti-idiotypic antibody against human angiotensin ii, unliganded form
Deposited on 1999-04-26, released 2003-08-05
The last revision prior to the SCOP 1.69 freeze date was dated 2003-08-05, with a file datestamp of 2003-08-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.192
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ck0H (H:)
    qvqlqesggglvqprgslklscaasgftfntdamnwvrqapgkglewvarirskgfnfat
    yyadsvrdrftisrddsqsmlylqmnnlktedtgiyycvrgrdgeamdywgqgttltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpssprpsetvtcnvahpasstkvdkkivn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ck0H (H:)
    qvqlqesggglvqprgslklscaasgftfntdamnwvrqapgkglewvarirskgfnfat
    yyadsvrdrftisrddsqsmlylqmnnlktedtgiyycvrgrdgeamdywgqgttltvss
    akttppsvyplapmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
    tvpssprpsetvtcnvahpasstkvdkkivn
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ck0L (L:)
    diqltqspsslavsagekvtmnckssqnllhsitrknylawyrqkpgqspklliywastr
    gsgvpdrftgsgsgtdftltissvqaedlavyyckqsynlytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr