PDB entry 1cjy

View 1cjy on RCSB PDB site
Description: human cytosolic phospholipase a2
Deposited on 1999-04-20, released 2000-04-20
The last revision prior to the SCOP 1.55 freeze date was dated 2000-04-20, with a file datestamp of 2000-04-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.229
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cjyA (A:)
    ehqyshkftvvvlratkvtkgafgdmldtpdpyvelfisttpdsrkrtrhfnndinpvwn
    etfefildpnqenvleitlmdanyvmdetlgtatftvssmkvgekkevpfifnqvtemvl
    emslevcscpdlrfsmalcdqektfrqqrkehiresmkkllgpknseglhsardvpvvai
    lgsgggframvgfsgvmkalyesgildcatyvaglsgstwymstlyshpdfpekgpeein
    eelmknvshnplllltpqkvkryveslwkkkssgqpvtftdifgmligetlihnrmnttl
    sslkekvntaqcplplftclhvkpdvselmfadwvefspyeigmakygtfmapdlfgskf
    fmgtvvkkyeenplhflmgvwgsafsilfnrvlgvsgsqsrgstmeeelenittkhivsn
    dssdsddeshepkgtenedagsdyqsdnqaswihrmimalvsdsalfntregragkvhnf
    mlglnlntsyplsplsdfatqdsfdddeldaavadpdeferiyepldvkskkihvvdsgl
    tfnlpyplilrpqrgvdliisfdfsarpsdssppfkelllaekwakmnklpfpkidpyvf
    dreglkecyvfkpknpdmekdcptiihfvlaninfrkykapgvpreteeekeiadfdifd
    dpespfstfnfqypnqafkrlhdlmhfntlnnidvikeamvesieyrrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjyA (A:)
    ehqyshkftvvvlratkvtkgafgdmldtpdpyvelfisttpdsrkrtrhfnndinpvwn
    etfefildpnqenvleitlmdanyvmdetlgtatftvssmkvgekkevpfifnqvtemvl
    emslevcscpdlrfsmalcdqektfrqqrkehiresmkkllgpknseglhsardvpvvai
    lgsgggframvgfsgvmkalyesgildcatyvaglsgstwymstlyshpdfpekgpeein
    eelmknvshnplllltpqkvkryveslwkkkssgqpvtftdifgmligetlihnrmnttl
    sslkekvntaqcplplftclhvkpdvselmfadwvefspyeigmakygtfmapdlfgskf
    fmgtvvkkyeenplhflmgvwgsafsilfnrvlstmeeelenittkhivsnnqaswihrm
    imalvsdsalfntregragkvhnfmlglnldvkskkihvvdsgltfnlpyplilrpqrgv
    dliisfdfsarpsdssppfkelllaekwakmnklpfpkidpyvfdreglkecyvfkpknp
    dmekdcptiihfvlaninfrkykapgvpreteeekeiadfdifddpespfstfnfqypnq
    afkrlhdlmhfntlnnidvikeamvesieyrrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cjyB (B:)
    qyshkftvvvlratkvtkgafgdmldtpdpyvelfisttpdsrkrtrhfnndinpvwnet
    fefildpnqenvleitlmdanyvmdetlgtatftvssmkvgekkevpfifnqvtemvlem
    slevcscpdlrfsmalcdqektfrqqrkehiresmkkllgpknseglhsardvpvvailg
    sgggframvgfsgvmkalyesgildcatyvaglsgstwymstlyshpdfpekgpeeinee
    lmknvshnplllltpqkvkryveslwkkkssgqpvtftdifgmligetlihnrmnttlss
    lkekvntaqcplplftclhvkpdvselmfadwvefspyeigmakygtfmapdlfgskffm
    gtvvkkyeenplhflmgvwgsafsilfnrvlgvsgsqsrgstmeeelenittkhivsnds
    sdsddeshepkgtenedagsdyqsdnqaswihrmimalvsdsalfntregragkvhnfml
    glnlntsyplsplsdfatqdsfdddeldaavadpdeferiyepldvkskkihvvdsgltf
    nlpyplilrpqrgvdliisfdfsarpsdssppfkelllaekwakmnklpfpkidpyvfdr
    eglkecyvfkpknpdmekdcptiihfvlaninfrkykapgvpreteeekeiadfdifddp
    espfstfnfqypnqafkrlhdlmhfntlnnidvikeamvesie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjyB (B:)
    qyshkftvvvlratkvtkgafgdmldtpdpyvelfisttpdsrkrtrhfnndinpvwnet
    fefildpnqenvleitlmdanyvmdetlgtatftvssmkvgekkevpfifnqvtemvlem
    slevcscpdlrfsmalcdqektfrqqrkehiresmkkllgpknseglhsardvpvvailg
    sgggframvgfsgvmkalyesgildcatyvaglsgstwymstlyshpdfpekgpeeinee
    lmknvshnplllltpqkvkryveslwkkkssgqpvtftdifgmligetlihnrmnttlss
    lkekvntaqcplplftclhvkpdvselmfadwvefspyeigmakygtfmapdlfgskffm
    gtvvkkyeenplhflmgvwgsafsilfnrvlgstmeeelenittkhivswihrmimalvs
    dsalfntregragkvhnfmlglndvkskkihvvdsgltfnlpyplilrpqrgvdliisfd
    fsarpsdssppfkelllaekwakmnklpfpkidpyvfdreglkecyvfkpdcptiihfvl
    aninfrkyapgvpreteeekeiadfdifddpespfstfnfqypnqafkrlhdlmhfntln
    nidvikeamvesie