PDB entry 1cjx

View 1cjx on RCSB PDB site
Description: crystal structure of pseudomonas fluorescens hppd
Deposited on 1999-04-20, released 2000-04-26
The last revision prior to the SCOP 1.57 freeze date was dated 2000-04-26, with a file datestamp of 2000-04-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.219
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjxA (A:)
    yenpmglmgfefiefasptpgtlepifeimgftkvathrsknvhlyrqgeinlilnnepn
    siasyfaaehgpsvcgmafrvkdsqkaynralelgaqpihidtgpmelnlpaikgiggap
    lylidrfgegssiydidfvylegvernpvgaglkvidhlthnvyrgrmvywanfyeklfn
    frearyfdikgeytgltskamsapdgmiriplneesskgagqieeflmqfngegiqhvaf
    ltddlvktwdalkkigmrfmtappdtyyemlegrlpdhgepvdqlqargilldgssvegd
    krlllqifsetlmgpvffefiqrkgddgfgegnfkalfesierdqvrrgvlat
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjxB (B:)
    yenpmglmgfefiefasptpgtlepifeimgftkvathrsknvhlyrqgeinlilnnepn
    siasyfaaehgpsvcgmafrvkdsqkaynralelgaqpihidtgpmelnlpaikgiggap
    lylidrfgegssiydidfvylegvernpvgaglkvidhlthnvyrgrmvywanfyeklfn
    frearyfdikgeytgltskamsapdgmiriplneesskgagqieeflmqfngegiqhvaf
    ltddlvktwdalkkigmrfmtappdtyyemlegrlpdhgepvdqlqargilldgssvegd
    krlllqifsetlmgpvffefiqrkgddgfgegnfkalfesierdqvrrgvlat
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjxC (C:)
    yenpmglmgfefiefasptpgtlepifeimgftkvathrsknvhlyrqgeinlilnnepn
    siasyfaaehgpsvcgmafrvkdsqkaynralelgaqpihidtgpmelnlpaikgiggap
    lylidrfgegssiydidfvylegvernpvgaglkvidhlthnvyrgrmvywanfyeklfn
    frearyfdikgeytgltskamsapdgmiriplneesskgagqieeflmqfngegiqhvaf
    ltddlvktwdalkkigmrfmtappdtyyemlegrlpdhgepvdqlqargilldgssvegd
    krlllqifsetlmgpvffefiqrkgddgfgegnfkalfesierdqvrrgvlat
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjxD (D:)
    yenpmglmgfefiefasptpgtlepifeimgftkvathrsknvhlyrqgeinlilnnepn
    siasyfaaehgpsvcgmafrvkdsqkaynralelgaqpihidtgpmelnlpaikgiggap
    lylidrfgegssiydidfvylegvernpvgaglkvidhlthnvyrgrmvywanfyeklfn
    frearyfdikgeytgltskamsapdgmiriplneesskgagqieeflmqfngegiqhvaf
    ltddlvktwdalkkigmrfmtappdtyyemlegrlpdhgepvdqlqargilldgssvegd
    krlllqifsetlmgpvffefiqrkgddgfgegnfkalfesierdqvrrgvlat