PDB entry 1cjw

View 1cjw on RCSB PDB site
Description: serotonin n-acetyltransferase complexed with a bisubstrate analog
Class: transferase
Keywords: n-acetyl transferase, transferase
Deposited on 1999-04-19, released 1999-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (serotonin n-acetyltransferase)
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1cjwa_
  • Heterogens: COT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjwA (A:)
    htlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlcpelslgwfvegr
    lvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvga
    qpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcsl