PDB entry 1cjw

View 1cjw on RCSB PDB site
Description: serotonin n-acetyltransferase complexed with a bisubstrate analog
Deposited on 1999-04-19, released 1999-05-06
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-06, with a file datestamp of 1999-05-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cjwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjwA (A:)
    htlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlcpelslgwfvegr
    lvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvga
    qpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcsl