PDB entry 1cjq

View 1cjq on RCSB PDB site
Description: x-ray crystallographic studies of the denaturation of the denaturation of ribonuclease s.
Deposited on 1999-04-19, released 1999-05-07
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-23, with a file datestamp of 1999-12-22.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.175
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cjq.1
  • Chain 'B':
    Domains in SCOP 1.55: d1cjq.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cjqA (A:)
ketaaakferqhmds

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cjqB (B:)
nycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystmsitd
cretgsskypncaykttqankhiivacegnpyvpvhfdasv