PDB entry 1cjq

View 1cjq on RCSB PDB site
Description: x-ray crystallographic studies of the denaturation of the denaturation of ribonuclease s.
Class: hydrolase
Keywords: ribonuclease, denaturation, hydrolase
Deposited on 1999-04-19, released 1999-05-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (ribonuclease s)
  Species: synthetic construct, synthetic [TaxId:32630]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-14)
  Domains in SCOPe 2.08: d1cjq.1
• Chain 'B':
  Compound: protein (ribonuclease s)
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-100)
  Domains in SCOPe 2.08: d1cjq.1
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cjqA (A:)
  ketaaakferqhmds
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cjqB (B:)
  nycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystmsitd
  cretgsskypncaykttqankhiivacegnpyvpvhfdasv