PDB entry 1cjq

View 1cjq on RCSB PDB site
Description: x-ray crystallographic studies of the denaturation of the denaturation of ribonuclease s.
Class: hydrolase
Keywords: ribonuclease, denaturation, hydrolase
Deposited on 1999-04-19, released 1999-05-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ribonuclease s)
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cjq.1
  • Chain 'B':
    Compound: protein (ribonuclease s)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cjq.1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjqA (A:)
    ketaaakferqhmds
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjqB (B:)
    nycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystmsitd
    cretgsskypncaykttqankhiivacegnpyvpvhfdasv