PDB entry 1cjm

View 1cjm on RCSB PDB site
Description: human sult1a3 with sulfate bound
Deposited on 1999-04-18, released 1999-11-10
The last revision prior to the SCOP 1.61 freeze date was dated 1999-11-10, with a file datestamp of 1999-11-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.276
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1cjma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cjmA (A:)
    srppleyvkgvplikyfaealgplqsfqarpddllintypksgttwvsqildmiyqggdl
    ekcnrapiyvrvpflevndpgepsgletlkdtppprlikshlplallpqtlldqkvkvvy
    varnpkdvavsyyhfhrmekahpepgtwdsflekfmagevsygswyqhvqewwelsrthp
    vlylfyedmkenpkreiqkilefvgrslpeetmdfmvqhtsfkemkknpmtnyttvpqel
    mdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjmA (A:)
    srppleyvkgvplikyfaealgplqsfqarpddllintypksgttwvsqildmiyqrvpf
    levndpgepetlkdtppprlikshlplallpqtlldqkvkvvyvarnpkdvavsyyhfhr
    mekahpepgtwdsflekfmagevsygswyqhvqewwelsrthpvlylfyedmkenpkrei
    qkilefvgrslgdwkttftvaqnerfdadyaekmagcslsfrs