PDB entry 1cjm

View 1cjm on RCSB PDB site
Description: human sult1a3 with sulfate bound
Class: transferase
Keywords: sult1a3, hast3, sulfotransferase, pap, paps, dopamine
Deposited on 1999-04-18, released 1999-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.276
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (aryl sulfotransferase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cjma_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cjmA (A:)
    meliqdtsrppleyvkgvplikyfaealgplqsfqarpddllintypksgttwvsqildm
    iyqggdlekcnrapiyvrvpflevndpgepsgletlkdtppprlikshlplallpqtlld
    qkvkvvyvarnpkdvavsyyhfhrmekahpepgtwdsflekfmagevsygswyqhvqeww
    elsrthpvlylfyedmkenpkreiqkilefvgrslpeetmdfmvqhtsfkemkknpmtny
    ttvpqelmdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjmA (A:)
    srppleyvkgvplikyfaealgplqsfqarpddllintypksgttwvsqildmiyqrvpf
    levndpgepetlkdtppprlikshlplallpqtlldqkvkvvyvarnpkdvavsyyhfhr
    mekahpepgtwdsflekfmagevsygswyqhvqewwelsrthpvlylfyedmkenpkrei
    qkilefvgrslgdwkttftvaqnerfdadyaekmagcslsfrs