PDB entry 1cjl

View 1cjl on RCSB PDB site
Description: crystal structure of a cysteine protease proform
Deposited on 1996-07-24, released 1997-08-12
The last revision prior to the SCOP 1.55 freeze date was dated 1997-08-12, with a file datestamp of 1997-08-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.182
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1cjl__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1cjl_ (-)
    dhsleaqwtkwkamhnrlygmneegwrravweknmkmielhnqeyregkhsftmamnafg
    dmtseefrqvmnglqnrkprkgkvfqeplfyeaprsvdwrekgyvtpvknqgqcgsswaf
    satgalegqmfrktgrlislseqnlvdcsgpegnegcngglmdyafqyvqdnggldsees
    ypyeateesckynpkysvandagfvdipkqekalmkavatvgpisvaidaghesflfyke
    giyfepdcssedmdhgvlvvgygfestesdgnkywlvknswgeewgmggyvkmakdrrnh
    cgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjl_ (-)
    dhsleaqwtkwkamhnrlygmneegwrravweknmkmielhnqeyregkhsftmamnafg
    dmtseefrqvmnglqnrkprkgkvfqeplfyeaprsvdwrekgyvtpvknqgqcgsswaf
    satgalegqmfrktgrlislseqnlvdcsgpegnegcngglmdyafqyvqdnggldsees
    ypyeateesckynpkysvandagfvdipkqekalmkavatvgpisvaidaghesflfyke
    giyfepdcssedmdhgvlvvgygfesnkywlvknswgeewgmggyvkmakdrrnhcgias
    aasyptv