PDB entry 1cjl

View 1cjl on RCSB PDB site
Description: crystal structure of a cysteine protease proform
Class: hydrolase
Keywords: propeptide, inhibitor, cysteine protease, hydrolase
Deposited on 1996-07-24, released 1997-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.182
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: procathepsin l
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07711 (96-311)
      • engineered (169)
      • engineered (116)
      • engineered (151)
      • engineered (201)
    Domains in SCOPe 2.07: d1cjla_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cjlA (A:)
    dhsleaqwtkwkamhnrlygmneegwrravweknmkmielhnqeyregkhsftmamnafg
    dmtseefrqvmnglqnrkprkgkvfqeplfyeaprsvdwrekgyvtpvknqgqcgsswaf
    satgalegqmfrktgrlislseqnlvdcsgpegnegcngglmdyafqyvqdnggldsees
    ypyeateesckynpkysvandagfvdipkqekalmkavatvgpisvaidaghesflfyke
    giyfepdcssedmdhgvlvvgygfestesdgnkywlvknswgeewgmggyvkmakdrrnh
    cgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjlA (A:)
    dhsleaqwtkwkamhnrlygmneegwrravweknmkmielhnqeyregkhsftmamnafg
    dmtseefrqvmnglqnrkprkgkvfqeplfyeaprsvdwrekgyvtpvknqgqcgsswaf
    satgalegqmfrktgrlislseqnlvdcsgpegnegcngglmdyafqyvqdnggldsees
    ypyeateesckynpkysvandagfvdipkqekalmkavatvgpisvaidaghesflfyke
    giyfepdcssedmdhgvlvvgygfesnkywlvknswgeewgmggyvkmakdrrnhcgias
    aasyptv