PDB entry 1cjd

View 1cjd on RCSB PDB site
Description: the bacteriophage prd1 coat protein, p3, is structurally similar to human adenovirus hexon
Deposited on 1999-04-12, released 1999-09-20
The last revision prior to the SCOP 1.55 freeze date was dated 1999-09-20, with a file datestamp of 1999-09-19.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.178
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cjda_
  • Chain 'B':
    Domains in SCOP 1.55: d1cjdb_
  • Chain 'C':
    Domains in SCOP 1.55: d1cjdc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjdA (A:)
    lrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvta
    aitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssmv
    tdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlkl
    efannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqngyilplidl
    stlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinylsqrtanfs
    dtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpktvnqnarll
    mgyeyftsr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjdB (B:)
    aalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkv
    taaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflss
    mvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrl
    klefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqngyilpli
    dlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinylsqrtan
    fsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpktvnqnar
    llmgyeyftsrt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cjdC (C:)
    rnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvtaa
    itnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssmvt
    dspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlkle
    fannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqngyilplidls
    tlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinylsqrtanfsd
    trkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpktvnqnarllm
    gyeyftsrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjdC (C:)
    rnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvtaa
    itnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssmvt
    dspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlkle
    fannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqyilplidlstl
    ynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinylsqrtanfsdtr
    kldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpktvnqnarllmgy
    eyftsrt