PDB entry 1cjc

View 1cjc on RCSB PDB site
Description: structure of adrenodoxin reductase of mitochondrial p450 systems
Class: oxidoreductase
Keywords: flavoenzyme, mad analysis, electron transferase, oxidoreductase
Deposited on 1999-04-12, released 1999-04-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (adrenodoxin reductase)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cjca1, d1cjca2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cjcA (A:)
    stqeqtpqicvvgsgpagfytaqhllkhhsrahvdiyekqlvpfglvrfgvapdhpevkn
    vintftqtarsdrcafygnvevgrdvtvqelqdayhavvlsygaedhqaldipgeelpgv
    fsarafvgwynglpenrelapdlscdtavilgqgnvaldvarilltppdhlektditeaa
    lgalrqsrvktvwivgrrgplqvaftikelremiqlpgtrpmldpadflglqdrikeaar
    prkrlmelllrtatekpgveeaarrasasrawglrffrspqqvlpspdgrraagirlavt
    rlegigeatravptgdvedlpcglvlssigyksrpidpsvpfdpklgvvpnmegrvvdvp
    glycsgwvkrgptgvitttmtdsfltgqillqdlkaghlpsgprpgsafikalldsrgvw
    pvsfsdwekldaeevsrgqasgkpreklldpqemlrllgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjcA (A:)
    tpqicvvgsgpagfytaqhllkhhsrahvdiyekqlvpfglvrfgvapdhpevknvintf
    tqtarsdrcafygnvevgrdvtvqelqdayhavvlsygaedhqaldipgeelpgvfsara
    fvgwynglpenrelapdlscdtavilgqgnvaldvarilltppdhlektditeaalgalr
    qsrvktvwivgrrgplqvaftikelremiqlpgtrpmldpadflglqdrikeaarprkrl
    melllrtatekpgveeaarrasasrawglrffrspqqvlpspdgrraagirlavtrlegi
    geatravptgdvedlpcglvlssigyksrpidpsvpfdpklgvvpnmegrvvdvpglycs
    gwvkrgptgvitttmtdsfltgqillqdlkaghlpsgprpgsafikalldsrgvwpvsfs
    dwekldaeevsrgqasgkpreklldpqemlrllgh